![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.4: Complement components [48251] (4 proteins) probably related to other families, but has no known enzymatic activity |
![]() | Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48253] (15 PDB entries) |
![]() | Domain d3d5sb_: 3d5s B: [157408] Other proteins in same PDB: d3d5sc1, d3d5sd_ automated match to d1c3da_ |
PDB Entry: 3d5s (more details), 2.3 Å
SCOPe Domain Sequences for d3d5sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5sb_ a.102.4.4 (B:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Human (Homo sapiens) [TaxId: 9606]} gsrstdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelik kgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlile kqkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsit kagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynv eatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap
Timeline for d3d5sb_: