Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) automatically mapped to Pfam PF01649 |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (2 species) |
Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
Domain d3d5ct1: 3d5c T:8-106 [157383] Other proteins in same PDB: d3d5cb1, d3d5cd1, d3d5ce1, d3d5cf1, d3d5cg1, d3d5ch1, d3d5ci1, d3d5cj1, d3d5ck1, d3d5cl1, d3d5cn1, d3d5co1, d3d5cp1, d3d5cq1, d3d5cr1, d3d5cs1, d3d5cu1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 3d5c (more details), 3.21 Å
SCOPe Domain Sequences for d3d5ct1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5ct1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d3d5ct1: