SCOP 1.67: Domain d1coja1: 1coj A:2-90

Lineage for d1coja1 (1coj A:2-90)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (9 species)

7. Species Aquifex pyrophilus [TaxId:2714] [46615] (1 PDB entry)

8. Domain d1coja1: 1coj A:2-90 [15737]
   Other proteins in same PDB: d1coja2
   complexed with fe; mutant

Details for d1coja1

PDB Entry: 1coj, 1.9 Å

PDB Description: fe-sod from aquifex pyrophilus, a hyperthermophilic bacterium

SCOP Domain Sequences for d1coja1:

Sequence; same for both SEQRES and ATOM records:

>d1coja1 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus}
vhklepkdhlkpqnlegisneqiephfeahykgyvakyneiqekladqnfadrskanqny
seyrelkveetfnymgvvlhelyfgmltp

Timeline for d1coja1:

• d1coja1 first appeared (with stable ids) in SCOP 1.55
  
• d1coja1 appears in SCOP 1.65
  
• d1coja1 appears in SCOP 1.69
  
• d1coja1 appears in the current release, SCOPe 2.08