Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
Domain d3d5as1: 3d5a S:4-81 [157352] Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5an1, d3d5aq1, d3d5ar1, d3d5at1, d3d5au1 automatically matched to d1ibms_ complexed with mg, zn |
PDB Entry: 3d5a (more details), 3.21 Å
SCOPe Domain Sequences for d3d5as1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5as1 i.1.1.1 (S:4-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} slkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvyit enmvghklgefaptrtyr
Timeline for d3d5as1: