SCOPe 2.02: Domain d3d38h2: 3d38 H:1-36

Lineage for d3d38h2 (3d38 H:1-36)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (11 PDB entries)
   synonym: blastochloris viridis

8. Domain d3d38h2: 3d38 H:1-36 [157275]
   Other proteins in same PDB: d3d38c1, d3d38h1, d3d38l1, d3d38m1
   automatically matched to d1dxrh2
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38h2

PDB Entry: 3d38, 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3d38h2:

Sequence; same for both SEQRES and ATOM records:

>d3d38h2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d3d38h2:

• d3d38h2 first appeared in SCOP 1.75
  
• d3d38h2 appears in SCOPe 2.01
  
• d3d38h2 appears in SCOPe 2.03
  
• d3d38h2 appears in the current release, SCOPe 2.08