Lineage for d3d31a1 (3d31 A:230-348)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 951219Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 951303Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 951350Protein Sulfate/molybdate ABC transporter, ATP-binding protein [159119] (1 species)
  7. 951351Species Methanosarcina acetivorans [TaxId:2214] [159120] (1 PDB entry)
    Uniprot Q8TTZ3 230-348
  8. 951352Domain d3d31a1: 3d31 A:230-348 [157261]
    Other proteins in same PDB: d3d31a2, d3d31b2, d3d31c1, d3d31d1
    complexed with wo4

Details for d3d31a1

PDB Entry: 3d31 (more details), 3 Å

PDB Description: modbc from methanosarcina acetivorans
PDB Compounds: (A:) Sulfate/molybdate ABC transporter, ATP-binding protein

SCOPe Domain Sequences for d3d31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d31a1 b.40.6.3 (A:230-348) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}
fenvlkgrvisaeqgllrirvgevvidaagdmevgdqvyaflrpenialsksstqssirn
slqgrvteawvlgalvrvkvdcgvplnvlitrrsaeemelspgvqiyarfkassvhvlr

SCOPe Domain Coordinates for d3d31a1:

Click to download the PDB-style file with coordinates for d3d31a1.
(The format of our PDB-style files is described here.)

Timeline for d3d31a1: