Lineage for d3d2fd2 (3d2f D:189-382)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605292Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [53071] (4 PDB entries)
  8. 1605381Domain d3d2fd2: 3d2f D:189-382 [157252]
    automated match to d1ngfa2
    complexed with atp, gol, k, mg

Details for d3d2fd2

PDB Entry: 3d2f (more details), 2.3 Å

PDB Description: crystal structure of a complex of sse1p and hsp70
PDB Compounds: (D:) Heat shock 70 kDa protein 1

SCOPe Domain Sequences for d3d2fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2fd2 c.55.1.1 (D:189-382) Heat shock protein 70kDa, ATPase fragment {Human (Homo sapiens) [TaxId: 9606]}
gkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkrk
hkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcsd
lfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpdea
vaygaavqaailmg

SCOPe Domain Coordinates for d3d2fd2:

Click to download the PDB-style file with coordinates for d3d2fd2.
(The format of our PDB-style files is described here.)

Timeline for d3d2fd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d2fd1