Lineage for d3d292_ (3d29 2:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1677317Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1677326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677688Domain d3d292_: 3d29 2: [157220]
    Other proteins in same PDB: d3d29a_, d3d29b_, d3d29c_, d3d29e_, d3d29f_, d3d29g_, d3d29o_, d3d29p_, d3d29q_, d3d29s_, d3d29t_, d3d29u_
    automated match to d1g0u2_
    complexed with feb

Details for d3d292_

PDB Entry: 3d29 (more details), 2.6 Å

PDB Description: proteasome inhibition by fellutamide b
PDB Compounds: (2:) Proteasome component PRE3 precursor

SCOPe Domain Sequences for d3d292_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d292_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d3d292_:

Click to download the PDB-style file with coordinates for d3d292_.
(The format of our PDB-style files is described here.)

Timeline for d3d292_: