![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) ![]() Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats automatically mapped to Pfam PF11155 |
![]() | Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins) |
![]() | Protein Uncharacterized protein BCE_G9241_1042 [158432] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [158433] (1 PDB entry) Uniprot Q4MW04 11-144! Uniprot Q4MW04 145-274 |
![]() | Domain d3d19e1: 3d19 E:18-144 [157184] automated match to d3d19a1 complexed with fe, mg |
PDB Entry: 3d19 (more details), 2.3 Å
SCOPe Domain Sequences for d3d19e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d19e1 a.29.13.1 (E:18-144) Uncharacterized protein BCE_G9241_1042 {Bacillus cereus [TaxId: 1396]} mfverslneirfwsrimkehsfflrlgfrcedtqlieeanqfyrlfehieqiahsytnet dpeqikrfnaevqqaatniwgfkrkilgliltcklpgqnnfpllvdhtsreadyfrkrli qlnegkl
Timeline for d3d19e1: