SCOPe 2.07: Domain d1du2a_: 1du2 A:

Lineage for d1du2a_ (1du2 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Theta subunit of DNA polymerase III [46577] (1 species)

7. Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)

8. Domain d1du2a_: 1du2 A: [15701]
   possible artefact structure; recently re-determined structure (PDB 2ae9) is similar to the HOT protein structure

Details for d1du2a_

PDB Entry: 1du2

PDB Description: solution structure of the theta subunit of dna polymerase iii

PDB Compounds: (A:) DNA polymerase III

SCOPe Domain Sequences for d1du2a_:

Sequence; same for both SEQRES and ATOM records:

>d1du2a_ a.237.1.1 (A:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

Timeline for d1du2a_:

• d1du2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1du2a_ appears in SCOPe 2.06
  
• d1du2a_ appears in the current release, SCOPe 2.08