Lineage for d1du2a_ (1du2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350976Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 2350977Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 2350978Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 2350984Protein Theta subunit of DNA polymerase III [46577] (1 species)
  7. 2350985Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)
  8. 2350989Domain d1du2a_: 1du2 A: [15701]
    possible artefact structure; recently re-determined structure (PDB 2ae9) is similar to the HOT protein structure

Details for d1du2a_

PDB Entry: 1du2 (more details)

PDB Description: solution structure of the theta subunit of dna polymerase iii
PDB Compounds: (A:) DNA polymerase III

SCOPe Domain Sequences for d1du2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du2a_ a.237.1.1 (A:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

SCOPe Domain Coordinates for d1du2a_:

Click to download the PDB-style file with coordinates for d1du2a_.
(The format of our PDB-style files is described here.)

Timeline for d1du2a_: