Lineage for d3cuel1 (3cue L:4-169)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594921Protein Rab11a [102362] (2 species)
  7. 1594922Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159558] (2 PDB entries)
  8. 1594925Domain d3cuel1: 3cue L:4-169 [156990]
    automatically matched to d1yzna1
    complexed with plm

Details for d3cuel1

PDB Entry: 3cue (more details), 3.7 Å

PDB Description: Crystal structure of a TRAPP subassembly activating the Rab Ypt1p
PDB Compounds: (L:) GTP-binding protein YPT1

SCOPe Domain Sequences for d3cuel1:

Sequence, based on SEQRES records: (download)

>d3cuel1 c.37.1.8 (L:4-169) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiwd
tagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkc
dlkdkrvveydvakefadankmpfletsaldstnvedafltmarqi

Sequence, based on observed residues (ATOM records): (download)

>d3cuel1 c.37.1.8 (L:4-169) Rab11a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eydylfklllignsgvgksclllrfsddyistigvdfkiktveldgktvklqiwdtagqe
rfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnkcdlkdk
rvveydvakefadankmpfletsaldstnvedafltmarqi

SCOPe Domain Coordinates for d3cuel1:

Click to download the PDB-style file with coordinates for d3cuel1.
(The format of our PDB-style files is described here.)

Timeline for d3cuel1: