Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.28: BaiE/LinA-like [160036] (5 proteins) PfamB PB000019; includes sequences of characterized enzymes BaiE and LinA |
Protein Uncharacterized protein NpunR1993 [160043] (1 species) |
Species Nostoc punctiforme [TaxId:272131] [160044] (1 PDB entry) Uniprot B2J4W9 9-170 |
Domain d3cu3a1: 3cu3 A:9-170 [156988] complexed with edo, mg, peg |
PDB Entry: 3cu3 (more details), 2 Å
SCOPe Domain Sequences for d3cu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} tttadesairafhrqmidawnrgsgegfaapfsetadfitfegthlkgrkeiaafhqqaf dtvvkgtrlegevdfvrfvnsqlalmlvvirvilpgqtetsasrdslplyvvtkgdegwq iegllntrkltlerqfflddfdslsaeaqrqvtdlvaslkqs
Timeline for d3cu3a1: