Lineage for d1bq0__ (1bq0 -)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (5 proteins) 
Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species) Species Escherichia coli [TaxId:562] [46572] (3 PDB entries) 
Domain d1bq0__: 1bq0 - [15698]
Details for d1bq0__
PDB Entry: 1bq0 (more details)
PDB Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures
SCOP Domain Sequences for d1bq0__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bq0__ a.2.3.1 (-) DnaJ chaperone, N-terminal (J) domain {Escherichia coli}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeqgg
SCOP Domain Coordinates for d1bq0__:
Click to download the PDB-style file with coordinates for d1bq0__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bq0__:
- d1bq0__ first appeared (with stable ids) in SCOP 1.55
- d1bq0__ appears in SCOP 1.63
- d1bq0__ appears in SCOP 1.67
- d1bq0__ appears in the current release, SCOPe 2.08, called d1bq0a_
View in 3D