Lineage for d1bq0a_ (1bq0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2302877Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2302878Family a.2.3.1: Chaperone J-domain [46566] (7 protein domains)
    Pfam PF00226
  6. 2302892Protein DnaJ chaperone, N-terminal (J) domain [46571] (1 species)
  7. 2302893Species Escherichia coli [TaxId:562] [46572] (3 PDB entries)
  8. 2302896Domain d1bq0a_: 1bq0 A: [15698]

Details for d1bq0a_

PDB Entry: 1bq0 (more details)

PDB Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures
PDB Compounds: (A:) dnaj

SCOPe Domain Sequences for d1bq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq0a_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]}
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeqgg

SCOPe Domain Coordinates for d1bq0a_:

Click to download the PDB-style file with coordinates for d1bq0a_.
(The format of our PDB-style files is described here.)

Timeline for d1bq0a_: