Lineage for d3cshb2 (3csh B:1-77)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992593Protein Class pi GST [81358] (4 species)
  7. 992594Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
  8. 992606Domain d3cshb2: 3csh B:1-77 [156964]
    Other proteins in same PDB: d3csha1, d3cshb1
    automatically matched to d1gssa2
    complexed with ca, cl, gsw, lz6, mes, so4

Details for d3cshb2

PDB Entry: 3csh (more details), 1.55 Å

PDB Description: crystal structure of glutathione transferase pi in complex with the chlorambucil-glutathione conjugate
PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3cshb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cshb2 c.47.1.5 (B:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlg

SCOPe Domain Coordinates for d3cshb2:

Click to download the PDB-style file with coordinates for d3cshb2.
(The format of our PDB-style files is described here.)

Timeline for d3cshb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cshb1