Lineage for d3cpjg1 (3cpj G:6-301)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109755Family c.3.1.3: GDI-like N domain [51931] (3 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. Protein automated matches [254667] (1 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255774] (3 PDB entries)
  8. 2109776Domain d3cpjg1: 3cpj G:6-301 [156899]
    Other proteins in same PDB: d3cpjg2, d3cpjg3
    automated match to d2bcgg1
    complexed with cl, gdp, mg

Details for d3cpjg1

PDB Entry: 3cpj (more details), 2.35 Å

PDB Description: crystal structure of ypt31 in complex with yeast rab-gdi
PDB Compounds: (G:) Rab GDP-dissociation inhibitor

SCOPe Domain Sequences for d3cpjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cpjg1 c.3.1.3 (G:6-301) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
idtdydvivlgtgitecilsgllsvdgkkvlhidkqdhyggeaasvtlsqlyekfkqnpi
skeereskfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiy
kvpaneieaissplmgifekrrmkkflewissykeddlsthqgldldkntmdevyykfgl
gnstkefighamalwtnddylqqparpsferillycqsvarygkspylypmyglgelpqg
farlsaiyggtymldtpidevlykkdtgkfegvktklgtfkaplviadptyfpekc

SCOPe Domain Coordinates for d3cpjg1:

Click to download the PDB-style file with coordinates for d3cpjg1.
(The format of our PDB-style files is described here.)

Timeline for d3cpjg1: