SCOPe 2.07: Domain d3clzb2: 3clz B:415-617

Lineage for d3clzb2 (3clz B:415-617)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.12: SRA domain-like [159368] (2 proteins)
   Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA

6. Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries)
   Uniprot Q96T88 409-615! Uniprot Q96T88 414-617

8. Domain d3clzb2: 3clz B:415-617 [156767]
   Other proteins in same PDB: d3clza3, d3clzb3, d3clzc3, d3clzd3
   automated match to d3bi7a1

Details for d3clzb2

PDB Entry: 3clz, 2.2 Å

PDB Description: The set and ring associated (SRA) domain of UHRF1 bound to methylated DNA

PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3clzb2:

Sequence; same for both SEQRES and ATOM records:

>d3clzb2 b.122.1.12 (B:415-617) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
snhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhgn
fftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwrsgkpvr
vvrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkeg
kdrikklgltmqypegylealan

Timeline for d3clzb2:

• d3clzb2 first appeared in SCOP 1.75, called d3clzb1
  
• d3clzb2 appears in SCOPe 2.06
  
• d3clzb2 appears in the current release, SCOPe 2.08