Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein Phycoerythrin beta subunit [88513] (4 species) |
Species Cryptophyte (Rhodomonas sp. CS24) [TaxId:79257] [46544] (3 PDB entries) |
Domain d1qgwc_: 1qgw C: [15673] Other proteins in same PDB: d1qgwa_, d1qgwb_ |
PDB Entry: 1qgw (more details), 1.63 Å
SCOP Domain Sequences for d1qgwc_:
Sequence, based on SEQRES records: (download)
>d1qgwc_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]} dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
>d1qgwc_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophyte (Rhodomonas sp. CS24) [TaxId: 79257]} dafsrvvaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenpslis psgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpansna ravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais
Timeline for d1qgwc_: