SCOP 1.71: Domain d1qgwc_: 1qgw C:

Lineage for d1qgwc_ (1qgw C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Cryptophite (Rhodomonas sp.), cs24 [46544] (3 PDB entries)

8. Domain d1qgwc_: 1qgw C: [15673]
   Other proteins in same PDB: d1qgwa_, d1qgwb_

Details for d1qgwc_

PDB Entry: 1qgw, 1.63 Å

PDB Description: crystal structure of phycoerythrin 545 from the marine cryptophyte rhodomonas cs24

SCOP Domain Sequences for d1qgwc_:

Sequence, based on SEQRES records:

>d1qgwc_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
dafsrvvtnadskaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmice
npslispsgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgv
pansnaravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Sequence, based on observed residues (ATOM records):

>d1qgwc_ a.1.1.3 (C:) Phycoerythrin beta subunit {Cryptophite (Rhodomonas sp.), cs24}
dafsrvvaayvggadlqalkkfisegnkrldsvnsivsnascivsdavsgmicenpslis
psgncytnrrmaaclrdgeiilryvsyallsgdasvledrclnglketysslgvpansna
ravsimkacavafvnntasqkklstpqgdcsglasevggyfdkvtaais

Timeline for d1qgwc_:

• d1qgwc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgwc_ appears in SCOP 1.69
  
• d1qgwc_ appears in SCOP 1.73
  
• d1qgwc_ appears in the current release, SCOPe 2.08