Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) |
Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries) Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70 |
Domain d3cjsb1: 3cjs B:1-70 [156714] protein/RNA complex; complexed with edo |
PDB Entry: 3cjs (more details), 1.37 Å
SCOPe Domain Sequences for d3cjsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cjsb1 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy adrsftfvtk
Timeline for d3cjsb1: