SCOPe 2.08: Domain d3cjsb1: 3cjs B:1-70

Lineage for d3cjsb1 (3cjs B:1-70)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
   Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70

8. Domain d3cjsb1: 3cjs B:1-70 [156714]
   protein/RNA complex; complexed with edo

Details for d3cjsb1

PDB Entry: 3cjs, 1.37 Å

PDB Description: Minimal Recognition Complex between PrmA and Ribosomal Protein L11

PDB Compounds: (B:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjsb1:

Sequence; same for both SEQRES and ATOM records:

>d3cjsb1 d.47.1.1 (B:1-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mkkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
adrsftfvtk

Timeline for d3cjsb1:

• d3cjsb1 first appeared in SCOP 1.75
  
• d3cjsb1 appears in SCOPe 2.07