Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (31 PDB entries) Uniprot P20065 55-179 |
Domain d3cipg_: 3cip G: [156678] Other proteins in same PDB: d3cipa1, d3cipa2 automated match to d1yagg_ complexed with atp, ca, gol, mg, so4 |
PDB Entry: 3cip (more details), 1.6 Å
SCOPe Domain Sequences for d3cipg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cipg_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} aghmvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnl qydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkyk kggvasgf
Timeline for d3cipg_: