Lineage for d1b8dk_ (1b8d K:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 94259Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
  6. 94321Protein Phycoerythrin [46540] (5 species)
  7. 94325Species Red alga (Griffithsia monilis) [TaxId:42003] [46542] (1 PDB entry)
  8. 94328Domain d1b8dk_: 1b8d K: [15667]

Details for d1b8dk_

PDB Entry: 1b8d (more details), 1.9 Å

PDB Description: crystal structure of a phycourobilin-containing phycoerythrin

SCOP Domain Sequences for d1b8dk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8dk_ a.1.1.3 (K:) Phycoerythrin {Red alga (Griffithsia monilis)}
mksvitttisaadaagrfpsssdlesiqgniqraaarleaaqklsgnheavvkeagdacf
akysylknageagdspekinkcyrdidhymrlinyslvvggtgpvdewgiagsrevyral
nlpgsayiaaftftrdrlcvprdmssqagveftsaldyvinslc

SCOP Domain Coordinates for d1b8dk_:

Click to download the PDB-style file with coordinates for d1b8dk_.
(The format of our PDB-style files is described here.)

Timeline for d1b8dk_: