SCOPe 2.03: Domain d3ci5g_: 3ci5 G:

Lineage for d3ci5g_ (3ci5 G:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (30 PDB entries)
   Uniprot P20065 55-179

8. Domain d3ci5g_: 3ci5 G: [156662]
   Other proteins in same PDB: d3ci5a1, d3ci5a2
   automated match to d1yagg_
   complexed with atp, ca, gol, mg, so4

Details for d3ci5g_

PDB Entry: 3ci5, 1.7 Å

PDB Description: complex of phosphorylated dictyostelium discoideum actin with gelsolin

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d3ci5g_:

Sequence; same for both SEQRES and ATOM records:

>d3ci5g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
hmvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqy
dlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkg
gvasgf

Timeline for d3ci5g_:

• d3ci5g_ first appeared in SCOP 1.75, called d3ci5g1
  
• d3ci5g_ appears in SCOPe 2.02
  
• d3ci5g_ appears in SCOPe 2.04
  
• d3ci5g_ appears in the current release, SCOPe 2.08, called d3ci5g2