Lineage for d3ci5a1 (3ci5 A:4-146)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373408Species Dictyostelium discoideum [225499] (2 PDB entries)
  8. 1373410Domain d3ci5a1: 3ci5 A:4-146 [199188]
    Other proteins in same PDB: d3ci5a2, d3ci5g_
    automated match to d1d4xa1
    complexed with atp, ca, gol, mg, so4

Details for d3ci5a1

PDB Entry: 3ci5 (more details), 1.7 Å

PDB Description: complex of phosphorylated dictyostelium discoideum actin with gelsolin
PDB Compounds: (A:) Major actin

SCOPe Domain Sequences for d3ci5a1:

Sequence, based on SEQRES records: (download)

>d3ci5a1 c.55.1.0 (A:4-146) automated matches {Dictyostelium discoideum}
dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim
fetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3ci5a1 c.55.1.0 (A:4-146) automated matches {Dictyostelium discoideum}
dvqalvidngsgmckagfagddapravfpsivgrprhtgmgqkdsyvgdeaqskrgiltl
kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf
ntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d3ci5a1:

Click to download the PDB-style file with coordinates for d3ci5a1.
(The format of our PDB-style files is described here.)

Timeline for d3ci5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ci5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ci5g_