Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (35 species) not a true protein |
Species Dictyostelium discoideum [225499] (2 PDB entries) |
Domain d3ci5a1: 3ci5 A:4-146 [199188] Other proteins in same PDB: d3ci5a2, d3ci5g_ automated match to d1d4xa1 complexed with atp, ca, gol, mg, so4 |
PDB Entry: 3ci5 (more details), 1.7 Å
SCOPe Domain Sequences for d3ci5a1:
Sequence, based on SEQRES records: (download)
>d3ci5a1 c.55.1.0 (A:4-146) automated matches {Dictyostelium discoideum} dvqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrg iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim fetfntpamyvaiqavlslyasg
>d3ci5a1 c.55.1.0 (A:4-146) automated matches {Dictyostelium discoideum} dvqalvidngsgmckagfagddapravfpsivgrprhtgmgqkdsyvgdeaqskrgiltl kypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetf ntpamyvaiqavlslyasg
Timeline for d3ci5a1: