Lineage for d1b8db_ (1b8d B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1256074Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 1256082Species Red alga (Griffithsia monilis) [TaxId:42003] [88515] (1 PDB entry)
  8. 1256083Domain d1b8db_: 1b8d B: [15666]
    Other proteins in same PDB: d1b8da_, d1b8dk_
    complexed with peb, pub

Details for d1b8db_

PDB Entry: 1b8d (more details), 1.9 Å

PDB Description: crystal structure of a phycourobilin-containing phycoerythrin
PDB Compounds: (B:) protein (rhodophytan phycoerythrin (beta chain))

SCOPe Domain Sequences for d1b8db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8db_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red alga (Griffithsia monilis) [TaxId: 42003]}
mldafsrvvvtsdakaayvggsdlqslksfindgnkrldavnyivsnascivsdavsgmi
cenpgliapggncytnrrmaaclrdgeiilryvsyallagdssvlddrclnglketyial
gvptasssravsimkatatafitntasgrkvevaagdcqalqaeaasyfdkvgssid

SCOPe Domain Coordinates for d1b8db_:

Click to download the PDB-style file with coordinates for d1b8db_.
(The format of our PDB-style files is described here.)

Timeline for d1b8db_: