SCOPe 2.04: Domain d3chra3: 3chr A:209-460

Lineage for d3chra3 (3chr A:209-460)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (4 proteins)
   adopts thermolysin-like fold

6. Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64340] (45 PDB entries)
   Uniprot P09960

8. Domain d3chra3: 3chr A:209-460 [156652]
   Other proteins in same PDB: d3chra1, d3chra2
   automated match to d3funa2
   complexed with 4bs, imd, yb, zn

Details for d3chra3

PDB Entry: 3chr, 2.2 Å

PDB Description: crystal structure of leukotriene a4 hydrolase in complex with 4-amino- n-[4-(phenylmethoxy)phenyl]-butanamide

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3chra3:

Sequence; same for both SEQRES and ATOM records:

>d3chra3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

Timeline for d3chra3:

• d3chra3 first appeared in SCOP 1.75
  
• d3chra3 appears in SCOPe 2.03
  
• d3chra3 appears in SCOPe 2.05
  
• d3chra3 appears in the current release, SCOPe 2.08