SCOPe 2.01: Domain d3chfa2: 3chf A:299-360

Lineage for d3chfa2 (3chf A:299-360)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase 1 [54562] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries)
   Uniprot Q873X9

8. Domain d3chfa2: 3chf A:299-360 [156638]
   Other proteins in same PDB: d3chfa1, d3chfb1
   automatically matched to d1w9pa2
   complexed with so4

Details for d3chfa2

PDB Entry: 3chf, 1.95 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with tetrapeptide

PDB Compounds: (A:) chitinase

SCOPe Domain Sequences for d3chfa2:

Sequence; same for both SEQRES and ATOM records:

>d3chfa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

Timeline for d3chfa2:

• d3chfa2 first appeared in SCOP 1.75
  
• d3chfa2 appears in SCOPe 2.02
  
• d3chfa2 appears in the current release, SCOPe 2.08