Lineage for d1cpcl_ (1cpc L:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 759877Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 759956Protein Phycocyanin beta subunit [88940] (6 species)
  7. 759957Species Cyanobacterium (Fremyella diplosiphon) [TaxId:1197] [88943] (1 PDB entry)
  8. 759959Domain d1cpcl_: 1cpc L: [15646]
    Other proteins in same PDB: d1cpca_, d1cpck_
    complexed with cyc, nma

Details for d1cpcl_

PDB Entry: 1cpc (more details), 1.66 Å

PDB Description: isolation, crystallization, crystal structure analysis and refinement of constitutive c-phycocyanin from the chromatically adapting cyanobacterium fremyella diplosiphon at 1.66 angstroms resolution
PDB Compounds: (L:) c-phycocyanin (beta subunit)

SCOP Domain Sequences for d1cpcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpcl_ a.1.1.3 (L:) Phycocyanin beta subunit {Cyanobacterium (Fremyella diplosiphon) [TaxId: 1197]}
mldafakvvsqadargeylsgsqidalsalvadgnkrmdvvnritgnsstivanaarslf
aeqpqliapggnaytsrrmaaclrdmeiilryvtyaifagdasvlddrclnglketylal
gtpgssvavgvqkmkdaalaiagdtngitrgdcaslmaevasyfdkaasava

SCOP Domain Coordinates for d1cpcl_:

Click to download the PDB-style file with coordinates for d1cpcl_.
(The format of our PDB-style files is described here.)

Timeline for d1cpcl_: