Lineage for d3ccsk1 (3ccs K:1-132)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. 1711354Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1711543Domain d3ccsk1: 3ccs K:1-132 [156413]
    Other proteins in same PDB: d3ccs21, d3ccsb1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsp1, d3ccsr1, d3ccss1, d3ccsy1, d3ccsz1
    automatically matched to d1w2bj_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsk1

PDB Entry: 3ccs (more details), 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d3ccsk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccsk1 i.1.1.2 (K:1-132) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d3ccsk1:

Click to download the PDB-style file with coordinates for d3ccsk1.
(The format of our PDB-style files is described here.)

Timeline for d3ccsk1: