![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Prokaryotic (50S subunit) [58125] (3 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccmt1: 3ccm T:1-119 [156349] Other proteins in same PDB: d3ccm21, d3ccmb1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmp1, d3ccmr1, d3ccms1, d3ccmy1, d3ccmz1 automatically matched to d1w2bs_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccm (more details), 2.55 Å
SCOPe Domain Sequences for d3ccmt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccmt1 i.1.1.2 (T:1-119) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d3ccmt1: