Lineage for d3ccmz1 (3ccm Z:35-106)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3036998Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 3036999Protein Ribosomal protein L37ae [57831] (1 species)
  7. 3037000Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 3037032Domain d3ccmz1: 3ccm Z:35-106 [156355]
    Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1
    automatically matched to d1s72z_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmz1

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3ccmz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccmz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOPe Domain Coordinates for d3ccmz1:

Click to download the PDB-style file with coordinates for d3ccmz1.
(The format of our PDB-style files is described here.)

Timeline for d3ccmz1: