Lineage for d3cbkb_ (3cbk B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376549Superfamily b.1.26: ICP-like [141066] (2 families) (S)
    topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
  5. 2376550Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB PB014070
    automatically mapped to Pfam PF09394
  6. 2376551Protein Chagasin [141068] (1 species)
  7. 2376552Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
    Uniprot Q966X9 3-110
  8. 2376561Domain d3cbkb_: 3cbk B: [156160]
    automated match to d2fo8a1

Details for d3cbkb_

PDB Entry: 3cbk (more details), 2.67 Å

PDB Description: chagasin-cathepsin b
PDB Compounds: (B:) Chagasin

SCOPe Domain Sequences for d3cbkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbkb_ b.1.26.1 (B:) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

SCOPe Domain Coordinates for d3cbkb_:

Click to download the PDB-style file with coordinates for d3cbkb_.
(The format of our PDB-style files is described here.)

Timeline for d3cbkb_: