Lineage for d3calc2 (3cal C:109-151)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243609Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1243610Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1243611Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 1243612Protein Fibronectin [57605] (1 species)
  7. 1243613Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1243621Domain d3calc2: 3cal C:109-151 [156154]
    automatically matched to d2cg6a1
    complexed with ace, nh2

Details for d3calc2

PDB Entry: 3cal (more details), 1.7 Å

PDB Description: crystal structure of the second and third fibronectin f1 modules in complex with a fragment of staphylococcus aureus fnbpa-5
PDB Compounds: (C:) Fibronectin

SCOPe Domain Sequences for d3calc2:

Sequence, based on SEQRES records: (download)

>d3calc2 g.27.1.1 (C:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphetggymlecvclgngkgewtckpi

Sequence, based on observed residues (ATOM records): (download)

>d3calc2 g.27.1.1 (C:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphegymlecvclgngkgewtckpi

SCOPe Domain Coordinates for d3calc2:

Click to download the PDB-style file with coordinates for d3calc2.
(The format of our PDB-style files is described here.)

Timeline for d3calc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3calc1