| Class g: Small proteins [56992] (98 folds) |
| Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
Superfamily g.27.1: FnI-like domain [57603] (3 families) ![]() |
| Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) automatically mapped to Pfam PF00039 |
| Protein Fibronectin [57605] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries) |
| Domain d3cala2: 3cal A:109-151 [156152] automatically matched to d2cg6a1 complexed with ace, nh2 |
PDB Entry: 3cal (more details), 1.7 Å
SCOPe Domain Sequences for d3cala2:
Sequence, based on SEQRES records: (download)
>d3cala2 g.27.1.1 (A:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrphetggymlecvclgngkgewtckpi
>d3cala2 g.27.1.1 (A:109-151) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
rcheggqsykigdtwrrpheggymlecvclgngkgewtckpi
Timeline for d3cala2: