Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins) |
Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries) Uniprot O67883 |
Domain d3c9ub1: 3c9u B:1-137 [156146] Other proteins in same PDB: d3c9ua2, d3c9ub2 automatically matched to d1vqva1 complexed with adp, mg, tpp |
PDB Entry: 3c9u (more details), 1.48 Å
SCOPe Domain Sequences for d3c9ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9ub1 d.79.4.1 (B:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]} mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni sksekigisvflvgete
Timeline for d3c9ub1: