Lineage for d3c92d1 (3c92 D:13-233)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1676715Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1677274Species Thermoplasma acidophilum [TaxId:2303] [56256] (3 PDB entries)
  8. 1677306Domain d3c92d1: 3c92 D:13-233 [156097]
    Other proteins in same PDB: d3c9211, d3c9221, d3c92h1, d3c92i1, d3c92j1, d3c92k1, d3c92l1, d3c92m1, d3c92n1, d3c92v1, d3c92w1, d3c92x1, d3c92y1, d3c92z1
    automatically matched to d1pmaa_

Details for d3c92d1

PDB Entry: 3c92 (more details), 6.8 Å

PDB Description: thermoplasma acidophilum 20s proteasome with a closed gate
PDB Compounds: (D:) Proteasome subunit alpha

SCOPe Domain Sequences for d3c92d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c92d1 d.153.1.4 (D:13-233) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d3c92d1:

Click to download the PDB-style file with coordinates for d3c92d1.
(The format of our PDB-style files is described here.)

Timeline for d3c92d1: