Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family) duplication: contains two domains of this fold |
Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [160779] (1 PDB entry) Uniprot Q59109 168-239,306-418 |
Domain d3c7bd3: 3c7b D:167-238,D:305-417 [156009] Other proteins in same PDB: d3c7ba1, d3c7ba2, d3c7bb1, d3c7bb2, d3c7bb3, d3c7bd1, d3c7bd2, d3c7be1, d3c7be2, d3c7be3 automatically matched to 3C7B A:167-238,A:305-417 complexed with sf4, so3, srm |
PDB Entry: 3c7b (more details), 2 Å
SCOP Domain Sequences for d3c7bd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7bd3 d.134.1.1 (D:167-238,D:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]} sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel kkrgmw
Timeline for d3c7bd3: