Lineage for d3c7bd3 (3c7b D:167-238,D:305-417)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873373Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 873374Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family) (S)
    duplication: contains two domains of this fold
  5. 873375Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 873376Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160777] (2 species)
  7. 873377Species Archaeoglobus fulgidus [TaxId:2234] [160779] (1 PDB entry)
    Uniprot Q59109 168-239,306-418
  8. 873379Domain d3c7bd3: 3c7b D:167-238,D:305-417 [156009]
    Other proteins in same PDB: d3c7ba1, d3c7ba2, d3c7bb1, d3c7bb2, d3c7bb3, d3c7bd1, d3c7bd2, d3c7be1, d3c7be2, d3c7be3
    automatically matched to 3C7B A:167-238,A:305-417
    complexed with sf4, so3, srm

Details for d3c7bd3

PDB Entry: 3c7b (more details), 2 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOP Domain Sequences for d3c7bd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7bd3 d.134.1.1 (D:167-238,D:305-417) Dissimilatory sulfite reductase subunit alpha, DsrA {Archaeoglobus fulgidus [TaxId: 2234]}
sdlrtpsacmgpalcefacydtlelcydltmtyqdelhrpmwpykfkikcagcpndcvas
karsdfaiigtwXrgatiliggkapfvegavigwvavpfvevekpydeikeileaiwdww
deegkfrerigeliwrkgmreflkvigreadvrmvkaprnnpfmffekdelkpsayteel
kkrgmw

SCOP Domain Coordinates for d3c7bd3:

Click to download the PDB-style file with coordinates for d3c7bd3.
(The format of our PDB-style files is described here.)

Timeline for d3c7bd3:

  • d3c7bd3 is new in SCOP 1.75
  • d3c7bd3 does not appear in SCOPe 2.01