Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d3c7be2 (3c7b E:4-122)

  1. Root: SCOP 1.75
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 protein domains)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. Protein Dissimilatory sulfite reductase subunit beta, DsrB [160340] (2 species)
  7. Species Archaeoglobus fulgidus [TaxId:2234] [160341] (1 PDB entry)
    Uniprot Q59110 4-122
  8. Domain d3c7be2: 3c7b E:4-122 [156011]
    Other proteins in same PDB: d3c7ba1, d3c7ba2, d3c7ba3, d3c7bb1, d3c7bb3, d3c7bd1, d3c7bd2, d3c7bd3, d3c7be1, d3c7be3
    automatically matched to 3C7B B:4-122
    complexed with sf4, so3, srm

Details for d3c7be2

PDB Entry: 3c7b (more details)
PDB Description: structure of the dissimilatory sulfite reductase from archae fulgidus
PDB Compounds: (E:) sulfite reductase, dissimilatory-type subunit beta

SCOP Domain Sequences for d3c7be2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7be2 d.58.36.2 (E:4-122) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
egvktdfgppyfrdllhpviaknygkwkyhevvkpgvikrvaesgdviyvvrfgtprlls
iytvrelcdiadkysdgylrwtsrnnveffvtdeskiddlinevqervgfpcggtwdav

SCOP Domain Coordinates for d3c7be2:

Click to download the PDB-style file with coordinates for d3c7be2.
(The format of our PDB-style files is described here.)

Timeline for d3c7be2:

d3c7be2 is new in SCOP 1.75
d3c7be2 became obsolete in SCOP 1.75A


d3c7be2
(click for larger image)


d3c7be2 in context of chain
Domains from same chain:
d3c7be1, d3c7be3


d3c7be2 in context of PDB
Domains from other chains:
d3c7ba1, d3c7ba2, d3c7ba3, d3c7bb1, d3c7bb2, d3c7bb3, d3c7bd1, d3c7bd2, d3c7bd3

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu