Lineage for d3c5zg2 (3c5z G:1-82)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021292Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1021365Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 1021376Domain d3c5zg2: 3c5z G:1-82 [155958]
    Other proteins in same PDB: d3c5zc1, d3c5zd1, d3c5zd2, d3c5zg1, d3c5zh1, d3c5zh2
    automatically matched to d1k2da2

Details for d3c5zg2

PDB Entry: 3c5z (more details), 2.55 Å

PDB Description: crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr b3k506
PDB Compounds: (G:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d3c5zg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5zg2 d.19.1.1 (G:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstp

SCOPe Domain Coordinates for d3c5zg2:

Click to download the PDB-style file with coordinates for d3c5zg2.
(The format of our PDB-style files is described here.)

Timeline for d3c5zg2: