SCOP 1.75: Domain d3c5wc1: 3c5w C:6-293

Lineage for d3c5wc1 (3c5w C:6-293)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)

6. Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143934] (7 PDB entries)
   Uniprot P67775 2-294

8. Domain d3c5wc1: 3c5w C:6-293 [155952]
   automatically matched to 2IE4 C:6-293

Details for d3c5wc1

PDB Entry: 3c5w, 2.8 Å

PDB Description: complex between pp2a-specific methylesterase pme-1 and pp2a core enzyme

PDB Compounds: (C:) PP2A C subunit

SCOP Domain Sequences for d3c5wc1:

Sequence; same for both SEQRES and ATOM records:

>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

Timeline for d3c5wc1:

• d3c5wc1 is new in SCOP 1.75
  
• d3c5wc1 is called d3c5wc_ in SCOPe 2.01
  
• d3c5wc1 appears in the current release, SCOPe 2.08, called d3c5wc_