PDB entry 3c5w

View 3c5w on RCSB PDB site
Description: Complex between PP2A-specific methylesterase PME-1 and PP2A core enzyme
Class: hydrolase
Keywords: methylesterase, phosphatase, PP2A, HYDROLASE
Deposited on 2008-02-01, released 2008-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-10, with a file datestamp of 2008-06-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PP2A A subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: PP2A C subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3c5wc1
  • Chain 'P':
    Compound: PP2A-specific methylesterase PME-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y570 (4-203)
      • see remark 999 (121)
      • see remark 999 (206)
    • Uniprot Q9Y570 (207-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c5wC (C:)
    gmdekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvh
    gqfhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhe
    srqitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldh
    iraldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsr
    ahqlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaprrgeph
    vtrrtpdyfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c5wC (C:)
    ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
    melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
    vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
    lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
    egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaptpdyfl
    

  • Chain 'P':
    No sequence available.