Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries) |
Domain d3c5gb1: 3c5g B:245-328 [155946] Other proteins in same PDB: d3c5ga2, d3c5ga3, d3c5gb2, d3c5gb3 automated match to d1rzta1 protein/DNA complex; complexed with d3t, edo, mg, na; mutant |
PDB Entry: 3c5g (more details), 2.2 Å
SCOPe Domain Sequences for d3c5gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c5gb1 a.60.6.1 (B:245-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} ssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipg igkrmaekiieilesghlrkldhi
Timeline for d3c5gb1: