Lineage for d3c5ga1 (3c5g A:249-328)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329042Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329043Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2329212Protein DNA polymerase lambda [101251] (1 species)
  7. 2329213Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2329250Domain d3c5ga1: 3c5g A:249-328 [155943]
    Other proteins in same PDB: d3c5ga2, d3c5ga3, d3c5gb2, d3c5gb3
    automated match to d1rzta1
    protein/DNA complex; complexed with d3t, edo, mg, na; mutant

Details for d3c5ga1

PDB Entry: 3c5g (more details), 2.2 Å

PDB Description: structure of a ternary complex of the r517k pol lambda mutant
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3c5ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c5ga1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

SCOPe Domain Coordinates for d3c5ga1:

Click to download the PDB-style file with coordinates for d3c5ga1.
(The format of our PDB-style files is described here.)

Timeline for d3c5ga1: