Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein beta-Lactamase, class A [56606] (15 species) |
Species Klebsiella pneumoniae, SHV-2 [TaxId:573] [90082] (10 PDB entries) almost identical sequence to SHV-1 |
Domain d3c4pa_: 3c4p A: [155935] Other proteins in same PDB: d3c4pb_ automated match to d1n9ba_ complexed with so4 |
PDB Entry: 3c4p (more details), 1.75 Å
SCOPe Domain Sequences for d3c4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c4pa_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]} spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd tpasmaernqqiagigaaliehwqr
Timeline for d3c4pa_: