SCOPe 2.08: Domain d3c3tb2: 3c3t B:84-196

Lineage for d3c3tb2 (3c3t B:84-196)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d3c3tb2: 3c3t B:84-196 [155922]
   Other proteins in same PDB: d3c3ta1, d3c3tb1
   automated match to d1xila2
   complexed with mn, so4

Details for d3c3tb2

PDB Entry: 3c3t, 2.2 Å

PDB Description: role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase

PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3c3tb2:

Sequence; same for both SEQRES and ATOM records:

>d3c3tb2 d.44.1.1 (B:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwdhayylqyknvrpdylkaiwnvinwenvterymac

Timeline for d3c3tb2:

• d3c3tb2 first appeared in SCOP 1.75
  
• d3c3tb2 appears in SCOPe 2.07