PDB entry 3c3t

View 3c3t on RCSB PDB site
Description: Role of a Glutamate Bridge Spanning the Dimeric Interface of Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: metalloenzyme, Manganese, Metal-binding, Mitochondrion, Oxidoreductase, Transit peptide
Deposited on 2008-01-28, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (161)
    Domains in SCOPe 2.07: d3c3ta1, d3c3ta2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-End)
      • engineered (161)
    Domains in SCOPe 2.07: d3c3tb1, d3c3tb2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c3tA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwdhayylqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3tA (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwdhayylqyknvrpdylkai
    wnvinwenvterymac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c3tB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwdhayylqyknvrpdylkai
    wnvinwenvterymackk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c3tB (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwdhayylqyknvrpdylkai
    wnvinwenvterymac