Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries) |
Domain d3c1cg1: 3c1c G:1016-1118 [155863] Other proteins in same PDB: d3c1cb1, d3c1cd1, d3c1cf1, d3c1ch1 automatically matched to d1aoic_ complexed with m2l |
PDB Entry: 3c1c (more details), 3.15 Å
SCOP Domain Sequences for d3c1cg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1cg1 a.22.1.1 (G:1016-1118) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} trssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnkk triiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
Timeline for d3c1cg1: