| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries) |
| Domain d3c1bc1: 3c1b C:814-918 [155853] Other proteins in same PDB: d3c1ba_, d3c1bb_, d3c1bd1, d3c1be_, d3c1bf_, d3c1bh1 automatically matched to d1aoic_ protein/DNA complex |
PDB Entry: 3c1b (more details), 2.2 Å
SCOPe Domain Sequences for d3c1bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1bc1 a.22.1.1 (C:814-918) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
Timeline for d3c1bc1: