SCOPe 2.08: Domain d3c09h1: 3c09 H:2-121

Lineage for d3c09h1 (3c09 H:2-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d3c09h1: 3c09 H:2-121 [155817]
   Other proteins in same PDB: d3c09a1, d3c09a2, d3c09a3, d3c09c2, d3c09d1, d3c09d2, d3c09d3, d3c09h2
   automatically matched to d8fabb1
   complexed with bma, man, nag

Details for d3c09h1

PDB Entry: 3c09, 3.2 Å

PDB Description: crystal structure the fab fragment of matuzumab (fab72000) in complex with domain iii of the extracellular region of egfr

PDB Compounds: (H:) Matuzumab Fab Heavy chain

SCOPe Domain Sequences for d3c09h1:

Sequence; same for both SEQRES and ATOM records:

>d3c09h1 b.1.1.1 (H:2-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
vqlvqsgaevkkpgasvkvsckasgytftshwmhwvrqapgqglewigefnpsngrtnyn
ekfkskatmtvdtstntaymelsslrsedtavyycasrdydyagryfdywgqgtlvtvss

Timeline for d3c09h1:

• d3c09h1 first appeared in SCOP 1.75
  
• d3c09h1 appears in SCOPe 2.07